PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.066610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 285aa    MW: 32317.1 Da    PI: 9.4622
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.066610.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18e-10941311954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  Cucsa.066610.1  94 FEHflHPYPTDTDKLMLANQTGLSRSQVSNWFINARVR 131
                     665559******************************98 PP

2BELL47.93.3e-161433072
            BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                    +q+v+  Fe +aglg+a+pY++lA ka+ +hFr Lk+aia+q+
  Cucsa.066610.1  1 MQAVVTTFEYAAGLGNAAPYANLAIKAMFKHFRFLKNAIADQL 43
                    9****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075268.2E-12140IPR006563POX domain
PROSITE profilePS5007111.95372135IPR001356Homeobox domain
CDDcd000867.05E-1375136No hitNo description
SMARTSM003896.0E-1075139IPR001356Homeobox domain
SuperFamilySSF466899.84E-1877142IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-2878139IPR009057Homeodomain-like
PfamPF059201.3E-1892131IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MQAVVTTFEY AAGLGNAAPY ANLAIKAMFK HFRFLKNAIA DQLQFNKQQQ QQPNPYSQRS  60
IHNHSPGFLD HQPVWRPQRG LPESAVTILR AWLFEHFLHP YPTDTDKLML ANQTGLSRSQ  120
VSNWFINARV RLWKPMVEEI HMLETRQAQK SQQKEDKNNN NNNIENNSAL NNINNNNDPL  180
SSTNESLLKP HHNNNASSSN HHHHPSLDLS NTNFFPTHHP HAAPGNISLT LGLHQNHPGG  240
IALTEPFPIN AAHHFNLDSE FLNSSSTNRS RLFTCHLKWI VIVI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-1681139563Homeobox protein Meis2
3k2a_A2e-1681139563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818880.0LN681888.1 Cucumis melo genomic scaffold, anchoredscaffold00002.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004142184.10.0PREDICTED: BEL1-like homeodomain protein 9 isoform X1
SwissprotQ9LZM83e-68BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A0A0KZQ80.0A0A0A0KZQ8_CUCSA; Uncharacterized protein
STRINGVIT_08s0007g01290.t013e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.17e-58TALE family protein